PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr6P11780_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family GRAS
Protein Properties Length: 342aa    MW: 38338 Da    PI: 5.49
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr6P11780_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS398.85.8e-122234231374
                   GRAS  31 aspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaNqaIleavegeervHiiDfd 118
                            +s +gdp qRl ay++e+Laar+a+s+ +lykal+++e +   +s++l+a+++++ev+P++kf++++aN  I ea+  ee+vHiiDfd
  GSMUA_Achr6P11780_001   2 VSIQGDPPQRLSAYMVEGLAARIASSGRGLYKALKCKEPP---TSDQLSAMQILFEVCPCFKFGYMAANYIIIEAFRDEEKVHIIDFD 86 
                            799************************************9...89******************************************* PP

                   GRAS 119 isqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledleleeLrvkpgEalaV 204
                            ++qG Q+++L+q+L++ p++pp+lRi +v++pes+      le +g+rL+k+Aeelgvpfef++ +a +  d+++ +L+ + gEal+V
  GSMUA_Achr6P11780_001  87 LNQGSQYINLIQTLSTWPHKPPHLRISAVDDPESVqrAVGGLEIIGRRLEKLAEELGVPFEFSA-IAVKSGDVTPGMLDRRLGEALVV 173
                            *********************************99878889***********************.688999***************** PP

                   GRAS 205 nlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgr 292
                            n+++qlh+++desvs+ ++rde+L++vk+l Pk+v+vveq++++n+++Fl rf+e  +yysa+fdsl+a+lpr+s++r++vEr++l+r
  GSMUA_Achr6P11780_001 174 NFAFQLHHMPDESVSTVNQRDELLRMVKGLGPKLVTVVEQDMNTNTAPFLPRFMEVYNYYSAVFDSLDATLPRDSSDRMNVERQCLAR 261
                            **************************************************************************************** PP

                   GRAS 293 eivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                            +ivn+vacega+r+er e ++kWr+r+++aGF + p++++++  +++l   + ++ y+++eesg+l++gW+d++Lv++SaWr
  GSMUA_Achr6P11780_001 262 DIVNIVACEGADRIERYEVAGKWRARMTMAGFVSCPFGTNVNGLVRALSGSYCDR-YKIKEESGALYFGWEDKTLVVTSAWR 342
                            ***********************************************99999955.*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098560.8631323IPR005202Transcription factor GRAS
PfamPF035142.0E-1192342IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 342 aa     Download sequence    Send to blast
MVSIQGDPPQ RLSAYMVEGL AARIASSGRG LYKALKCKEP PTSDQLSAMQ ILFEVCPCFK  60
FGYMAANYII IEAFRDEEKV HIIDFDLNQG SQYINLIQTL STWPHKPPHL RISAVDDPES  120
VQRAVGGLEI IGRRLEKLAE ELGVPFEFSA IAVKSGDVTP GMLDRRLGEA LVVNFAFQLH  180
HMPDESVSTV NQRDELLRMV KGLGPKLVTV VEQDMNTNTA PFLPRFMEVY NYYSAVFDSL  240
DATLPRDSSD RMNVERQCLA RDIVNIVACE GADRIERYEV AGKWRARMTM AGFVSCPFGT  300
NVNGLVRALS GSYCDRYKIK EESGALYFGW EDKTLVVTSA WR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A4e-52634237375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009404197.10.0PREDICTED: scarecrow-like protein 1
RefseqXP_009404196.10.0PREDICTED: scarecrow-like protein 1
RefseqXP_009404195.10.0PREDICTED: scarecrow-like protein 1
RefseqXP_009404194.10.0PREDICTED: scarecrow-like protein 1
SwissprotQ9SDQ31e-176SCL1_ARATH; Scarecrow-like protein 1
TrEMBLM0T6760.0M0T676_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr6P11780_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP51753860
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G21450.11e-177SCARECROW-like 1